Sequence: SGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQH
-; DNA repair protein XRCC3; X-ray repair complementing defective repair in Chinese hamster cells 3; X-ray repair cross-complementing protein 3
Cat # 16197585
100 µg
Cat # 11595303
100 µL
Cat # 16075057
100 uL
Cat # 16177585
100 µL
Cat # 16898504
20 µL
Cat # 15902465
100 µL
Cat # 16888504
150 µL
Cat # 16025636
100 uL
Cat # 15912535
100 µL
Cat # 13209228
100 µg
Cat # 13441207
100 µL
Cat # 16324305
100 µg
Cat # 11558253
100 µL
Cat # 16322765
50 µL
Cat # 15717185
0.1 ml
Cat # 16363765
100 µL
Cat # 16372135
100 µL
Cat # 16187585
100 µg
Cat # 16019586
100 uL
Cat # 16508911
100 µL
Cat # 15925805
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.