Sequence: FHPNRSAETKCDEIDGKPVLRECRMRYFLME
X Kell blood group precursor-related family, member 9; X-linked Kx blood group related 9; XK, Kell blood group complex subunit-related family, member 9; XK-related protein 9; XRG9
Cat # 16004717
100 uL
Cat # 15788531
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.