Sequence: HAPPTYEDVIAGHILDISDSPKEVRKNFQKTWQESGRVFKGLGYATADASATEMRTTFQEESAFISEAAAPRQGNMYTLSKDSLSNGVP
Beta-xin; cardiomyopathy associated 3; Cardiomyopathy-associated protein 3; CMYA3/DKFZp451G055/DKFZp779G1747/FLJ39111/FLJ40200/MYOMAXIN; myomaxin; Xeplin; xin actin-binding repeat containing 2; Xin actin-binding repeat-containing protein 2; xin repeat protein 2
Cat # 16165320
100 uL
Cat # 15744971
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.