Sequence: MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHSELRERKGREGE
LAIR homolog; MGC119160/MGC119161/UNQ3033; OSCAR-like transcript-1; Signal inhibitory receptor on leukocytes-1; SIRL-1; V-set and transmembrane domain-containing protein 1
Cat # 16137429
100 ug
Cat # 17195263
100 µg
Cat # 16822855
20 µL
Cat # 17139135
100 µL
Cat # 17149135
100 µL
Cat # 16812855
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.