Sequence: PPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYL
complement receptor of the immunoglobulin superfamily; CRIg/Z39IG; Ig superfamily protein; Protein Z39Ig; V-set and immunoglobulin domain-containing protein 4
Cat # 16154040
100 uL
Cat # 16370614
100 µg
Cat # 16360704
100 µg
Cat # 16361274
25 Tests
Cat # 16370704
25 Tests
Cat # 16328174
100 µL
Cat # 16351504
25 Tests
Cat # 15901992
100 µg
Cat # 16371274
100 Tests
Cat # 16320784
25 µg
Cat # 16321664
100 Tests
Cat # 13418854
100 ug
Cat # 16380704
100 Tests
Cat # 16340994
100 µg
Cat # 16311664
25 Tests
Cat # 15759970
100 µL
Cat # 16330784
25 Tests
Cat # 15957052
100 Tests
Cat # 16311094
100 µg
Cat # 15515202
100 µL
Cat # 16350704
25 µg
Cat # 13448834
100 ug
Cat # 16321504
100 µg
Cat # 16330994
25 µg
Cat # 16321274
25 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.