Sequence: SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV
hVPS18; KIAA1475/PEP3; vacuolar protein sorting 18 homolog; vacuolar protein sorting protein 18; Vacuolar protein sorting-associated protein 18 homolog; VPS18 CORVET/HOPS core subunit
Cat # 16109196
50 uL
Cat # 17226733
100 µL
Cat # 16317244
100 µl
Cat # 15559112
100 µg
Cat # 16142833
100 µg
Cat # 16857593
150 µL
Cat # 16867593
20 µL
Cat # 16162833
100 µg
Cat # 16119196
200 uL
Cat # 16152833
100 µg
Cat # 15797111
100 µL
Cat # 16102679
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.