Sequence: IGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK
hVPS16; vacuolar protein sorting 16 homolog; vacuolar protein sorting protein 16; Vacuolar protein sorting-associated protein 16 homolog; VPS16 CORVET/HOPS core subunit
Cat # 16103663
100 µg
Cat # 16827754
150 µL
Cat # 16538001
100 µL
Cat # 16193239
50 µg
Cat # 16330605
100 µL
Cat # 13229898
100 µL
Cat # 16837754
20 µL
Cat # 16636574
100 µL
Cat # 17190104
100 µL
Cat # 16183239
50 µL
Cat # 15594891
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.