Sequence: QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
8HS20/N27C7-2; N27C7-2; pre-B lymphocyte gene 3; Pre-B lymphocyte protein 3; Protein VPreB3
Cat # 16136910
100 uL
Cat # 16136076
50 µg
Cat # 16023347
100 ug
Cat # 16116076
50 uL
Cat # 16146076
100 µg
Cat # 15749760
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.