Sequence: NFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLG
MGC111064/PORIN/PORIN-31-HL; Outer mitochondrial membrane protein porin 1; Plasmalemmal porin; Porin 31HL; Porin 31HM; VDAC-1; Voltage-dependent anion-selective channel protein 1
Cat # 16004945
100 µg
Cat # 16131960
100 uL
Cat # 16014945
100 µg
Cat # 16013377
100 ug
Cat # 16089346
200 ug
Cat # 16041448
100 ug
Cat # 16024945
200 uL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.