Sequence: MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSM
MGC118976/MGC125730/MGC125796/VCX-8r/VCX-A/VCX3/VCX8R/VCXA; Variable charge protein on X with eight repeats; Variable charge X-linked protein 3; Variably charged protein X-A; variably charged X-A; VCX-8r; VCX-A
Cat # 16120509
50 µg
Cat # 16167046
100 µg
Cat # 15623365
400 µL
Cat # 16157046
50 uL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.