Sequence: QLHNVTAFQGKGHSLGTASGNPHLDPRARETSVVRKHNTGTDFSNSSTKTEPSVFTASSSNSELIRIAPGVVTMRDGRQLDPDLVEAQRKKLQEMVS
Deubiquitinating protein VCPIP1; DKFZp686G038/DUBA3/FLJ23132/FLJ60694/KIAA1850/VCIP135; valosin containing protein (p97)/p47 complex interacting protein 1; valosin-containing protein (p97)/p47 complex-interacting protein p135; Valosin-containing protein p97/p47 complex-interacting protein 1; Valosin-containing protein p97/p47 complex-interacting protein p135; VCP/p47 complex-interacting 135-kDa protein
Cat # 16150167
50 uL
Cat # 16857784
20 µL
Cat # 16847784
150 µL
Cat # 16312175
100 µL
Cat # 15752861
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.