Sequence: IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP
15S Mg(2+)-ATPase p97 subunit; epididymis luminal protein 220; epididymis secretory protein Li 70; IBMPFD/MGC131997/MGC148092/MGC8560/TERA/p97; TER ATPase; Transitional endoplasmic reticulum ATPase; Valosin-containing protein; VCP; yeast Cdc48p homolog
Cat # 16074935
100 ug
Cat # 16131812
100 ug
Cat # 16857405
150 µL
Cat # 16001486
50 ug
Cat # 16857313
20 µL
Cat # 13411517
100 µL
Cat # 17207183
100 µL
Cat # 15905785
100 µg
Cat # 12312393
100 µg
Cat # 11545722
100µg
Cat # 16867405
20 µL
Cat # 13279738
100 µL
Cat # 16847313
150 µL
Cat # 16323525
100 µL
Cat # 16031458
100 uL
Cat # 16349434
100 µL
Cat # 16372845
100 µL
Cat # 16597171
100 µL
Cat # 13423847
100 µL
Cat # 15915785
100 µg
Cat # 16121812
100 ug
Cat # 16309434
100 µL
Cat # 16326024
100 µL
Cat # 17185843
100 µL
Cat # 12332393
50 Tests
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.