Sequence: GGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATD
KIAA1036; TTCP 1; Tubulin carboxypeptidase 1; Tubulinyl-Tyr carboxypeptidase 1; Tyrosine carboxypeptidase 1; Vasohibin-1
Cat # 16174176
100 µg
Cat # 16599351
100 µL
Cat # 16810614
20 µL
Cat # 16638514
100 µL
Cat # 16118018
50 µg
Cat # 13494937
100 µL
Cat # 16800614
150 µL
Cat # 16064007
100 ug
Cat # 12839292
100 µg
Cat # 15759390
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.