Sequence: MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL
ALS8/VAMP-B/VAMP-C/VAP-B/VAP-C; VAMP (vesicle-associated membrane protein)-associated protein B and C; VAMP-associated 33 kDa protein; VAMP-B/VAMP-C; Vesicle-associated membrane protein-associated protein B/C
Cat # 16170166
50 ug
Cat # 16378164
100 µL
Cat # 16180166
50 ug
Cat # 15945775
100 µg
Cat # 16323664
100 µL
Cat # 17284696
100 µL
Cat # 16120176
100 ug
Cat # 15518282
100 µg
Cat # 15514012
100 µg
Cat # 16817845
150 µL
Cat # 17198483
100 µL
Cat # 16669204
100 µL
Cat # 16827845
20 µL
Cat # 15953245
100 µL
Cat # 15514042
100 µg
Cat # 17274796
100 µL
Cat # 16313664
100 µL
Cat # 16190166
100 uL
Cat # 15750971
100 µL
Cat # 16334464
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.