Sequence: DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL
SC1/SC1-1; TCF-19; Transcription factor 19; Transcription factor SC1
Cat # 16176375
100 µg
Cat # 16146375
50 uL
Cat # 11316163
100 µg
Cat # 16690635
100 µL
Cat # 13227808
100 µg
Cat # 15933375
100 µL
Cat # 16049677
100 ug
Cat # 16156375
50 µg
Cat # 17158393
100 µL
Cat # 13237828
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.