Sequence: GNISCMDFSSNGKYLATCADDRTIRIWSTKDFLQREHRSMRANVELDHATLVRFSPDCRAFIVWLANGDTLRVFKMTKREDGGYTFTATPEDFPKKHKAP
DKFZp434N024/MGC134739/WBSCR13/WS-betaTRP; transducin -like 2; Transducin beta-like protein 2; Williams-Beuren syndrome chromosomal region 13 protein; Williams-Beuren syndrome chromosome region 13; WS beta-transducin repeats protein; WS-betaTRP
Cat # 16135576
50 uL
Cat # 16165576
100 µL
Cat # 16828065
20 µL
Cat # 16155576
50 µg
Cat # 16810234
20 µL
Cat # 15556342
100 µL
Cat # 16818065
150 µL
Cat # 15892794
100 µL
Cat # 15938404
100 µL
Cat # 16800234
150 µL
Cat # 13465877
100 µL
Cat # 16175576
100 µg
Cat # 16145576
50 µL
Cat # 16623975
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.