Sequence: MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLHAVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIILPLREVVSIEKME
AD 3; AD3/HBLP1/VRP; BUB2-like protein 1; TBC1 domain family member 8; TBC1 domain family, member 8 (with GRAM domain); TBC1 domain family, member 8A; Vascular Rab-GAP/TBC-containing protein
Cat # 16143756
100 µg
Cat # 15947954
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.