Sequence: HLSTAFHLDSDLMLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFLQKNKEYVSIASGGFMALQQHLADINVDGPENGY
DKFZp667G062/FLJ11046/NS4ATP1; HCV non-structural protein 4A-transactivated protein 1; HCV nonstructural protein 4A-transactivated protein 1; TBC1 domain family member 23; TBC1 domain family, member 23
Cat # 16185790
100 uL
Cat # 16672875
100 µL
Cat # 16195790
100 uL
Cat # 15869253
100 µL
Cat # 16846814
150 µL
Cat # 16856814
20 µL
Cat # 15776151
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.