Sequence: LKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKK
150 kDa cofactor of initiator function; CIF150/TAF2B/TAFII150; cofactor of initiator function, 150kD subunit; RNA polymerase II TBP-associated factor subunit B; TAF(II)150; TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa; TATA box binding protein (TBP)-associated factor, RNA polymerase II, B, 150kD; TATA box binding protein associated factor 2; TBP-associated factor 150 kDa; Transcription initiation factor TFIID 150 kDa subunit; Transcription initiation factor TFIID subunit 2
Cat # 16126205
50 uL
Cat # 16162140
100 ug
Cat # 16142190
100 ug
Cat # 16122240
100 ug
Cat # 16152140
100 ug
Cat # 13271239
400 µL
Cat # 16112240
100 ug
Cat # 15564342
100 µL
Cat # 16172140
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.