Sequence: SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF
MGC:15243/PRO2134/TAF2I/TAFII28; TAF(II)28; TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa; TAFII-28; TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD; TATA box binding protein associated factor 11; TFIID subunit p30-beta; transcription initiation factor TFIID 28 kD subunit; Transcription initiation factor TFIID 28 kDa subunit; Transcription initiation factor TFIID subunit 11
Cat # 16004795
100 µg
Cat # 16014795
100 µg
Cat # 15988284
100 µL
Cat # 16024795
100 µg
Cat # 15967814
100 µL
Cat # 16569701
100 µL
Cat # 16084785
50 uL
Cat # 16885614
150 µL
Cat # 16034795
100 µg
Cat # 16895614
20 µL
Cat # 15514192
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.