Sequence: AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
ADA2(beta)/ADA2B/MGC21874; ADA2-beta; ADA2-like protein beta; Transcriptional adapter 2-beta; transcriptional adaptor 2 (ADA2 homolog, yeast)-beta
Cat # 16191267
50 uL
Cat # 16126833
100 µg
Cat # 16877244
150 µL
Cat # 15735291
100 µL
Cat # 16887244
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.