Sequence: MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYLNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME
KIAA-iso; SS18-like protein 2; synovial sarcoma translocation gene on chromosome 18-like 2; SYT homolog 2
Cat # 16159762
50 µL
Cat # 15709311
100 µL
Cat # 16169762
50 µg
Cat # 16839143
20 µL
Cat # 16829143
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.