Sequence: MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
-; Signal recognition particle 19 kDa protein; signal recognition particle 19kD; signal recognition particle 19kDa; SRP19
Cat # 16105855
50 µL
Cat # 16558421
100 µL
Cat # 15794556
100ul
Cat # 16135855
100 µg
Cat # 16125855
100 µL
Cat # 16825494
150 µL
Cat # 16115855
50 µg
Cat # 16636824
100 µL
Cat # 16835494
20 µL
Cat # 15595012
100 µL
Cat # 15774011
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.