Sequence: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
-; protein translocation complex beta; protein transport protein SEC61 beta subunit; Protein transport protein Sec61 subunit beta; Sec61 beta subunit; Sec61 complex, beta subunit
Cat # 16157538
100 µg
Cat # 16803714
20 µL
Cat # 16893704
150 µL
Cat # 16864094
20 µL
Cat # 11568731
100 µL
Cat # 16856285
150 µL
Cat # 16854094
150 µL
Cat # 16372535
100 µL
Cat # 16866285
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.