Sequence: NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLR
ABP125; ABP125/ABP130/DKFZp686N07171/HSPC275/HSPC334/KIAA0905/MGC90305/SEC31L1; ABP130; Protein transport protein Sec31A; SEC31 homolog A, COPII coating complex component; SEC31-like protein 1; SEC31-related protein A; Web1-like protein; yeast Sec31p homolog
Cat # 16113400
100 uL
Cat # 15673575
400 µL
Cat # 16817924
20 µL
Cat # 15868483
100 µL
Cat # 16510042
100 µL
Cat # 15730101
100 µL
Cat # 13472417
100 µL
Cat # 16395324
100 µL
Cat # 16807924
150 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.