Sequence: PLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSL
-; Protein transport protein Sec24A; SEC24 family member A; SEC24 family, member A; SEC24 related gene family, member A; SEC24-related protein A
Cat # 16153216
100 µg
Cat # 16805374
150 µL
Cat # 15726461
100 µL
Cat # 16815374
20 µL
Cat # 16666594
100 µL
Cat # 15998764
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.