Sequence: PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
FLJ26737/KIAA0310/RP11-413M3.10/SEC16L/p250; p250; protein SEC16 homolog A; Protein transport protein Sec16A; SEC16 homolog A
Cat # 16123410
100 uL
Cat # 15756227
0.1 ml
Cat # 15780131
100 µL
Cat # 15774357
0.1 ml
Cat # 17208663
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.