Sequence: LKCQGSPGASKAMLSCNRSGKKDTCALTCPSRARFLPESENGFTVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIKQRASFKIKDAKCRLHLRNK
CEGF3/DKFZp686B09105/DKFZp686B1223/DKFZp686D20108/FLJ34743; CUB domain and EGF-like repeat containing 3; Signal peptide, CUB and EGF-like domain-containing protein 3
Cat # 16142517
50 uL
Cat # 15355481
100 µg
Cat # 16886504
150 µL
Cat # 16065815
100 µg
Cat # 16065807
100 ug
Cat # 16896504
20 µL
Cat # 15395351
100 µg
Cat # 15757081
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.