Sequence: LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP
DKFZp547F072/SCRT; scratch family zinc finger 1; Scratch homolog 1 zinc finger protein; scratch homolog 1, zinc finger protein; SCRT; Transcriptional repressor scratch 1
Cat # 16024777
100 uL
Cat # 15715236
0.1 ml
Cat # 15778781
100 µL
Cat # 15826913
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.