Sequence: MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
-; neuronal voltage-gated sodium channel beta 2 subunit; Sodium channel subunit beta-2; sodium channel, voltage gated, type II beta subunit; sodium channel, voltage-gated, type II, beta polypeptide
Cat # 16120542
100 µg
Cat # 16881904
20 µL
Cat # 16378064
100 µL
Cat # 15932775
100 µL
Cat # 15994225
50 µL
Cat # 16549611
100 µL
Cat # 16129399
100 µg
Cat # 16119399
100 µg
Cat # 16871904
150 µL
Cat # 16668364
100 µL
Cat # 15526361
100 µg
Cat # 16382174
100 µg
Cat # 16179330
100 ug
Cat # 16189330
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.