Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYT
Acyl-CoA desaturase; Delta(9)-desaturase; Delta-9 desaturase; delta-9-desaturase; FADS5/MSTP008/SCD1; Fatty acid desaturase; hSCD1; predicted protein of HQ0998; Stearoyl-CoA desaturase; stearoyl-CoA desaturase (delta-9-desaturase); stearoyl-CoA desaturase opposite strand
Cat # 16104955
50 µg
Cat # 16040088
100 ug
Cat # 16113650
100 uL
Cat # 16578601
100 µL
Cat # 11366443
100 µg
Cat # 11546151
100 µL
Cat # 11526231
100 µL
Cat # 11590993
100 µg
Cat # 15932285
100 µL
Cat # 15927134
100 µg
Cat # 11337633
100 µg
Cat # 11549452
100 µg
Cat # 16802335
20 µL
Cat # 16114955
200 uL
Cat # 13278258
100 µL
Cat # 11574851
100 µL
Cat # 16061458
100 ug
Cat # 16892325
150 µL
Cat # 16031587
100 uL
Cat # 16150890
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.