Sequence: SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE
APC7/CSR/CSR1/MSLR1/MSRL1; Cellular stress response gene protein; cellular stress response protein; macrophage scavenger receptor-like 1; Scavenger receptor class A member 3; scavenger receptor class A, member 3
Cat # 16186966
50 uL
Cat # 16196966
100 µg
Cat # 15957824
100 µL
Cat # 13237658
100 µL
Cat # 16600575
100 µL
Cat # 15739311
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.