Sequence: SAFSSEAKLGLSHSQLTEELVASLHTENELDQADKELENTLRAQYEENIETGTDSSDIEENLSVTPKVAEKSPPESRLRFLSCVVCEKECTGVNSCISCDGNIHAICGVPSQHGTEGCGRQITCSLCYETSTMK
dJ1186N24.3 (novel zinc finger protein); DKFZp434N092/FLJ31087/KIAA1925/MGC131782/MGC133310/MGC133311/ZFP38-L/ZNF305P2/ZNF452/dJ1186N24.3; SCAN domain containing 3; SCAN domain-containing protein 3; Transposon-derived Buster4 transposase-like protein; Zinc finger BED domain-containing protein 9; zinc finger protein 305 pseudogene 2; zinc finger protein 452; zinc finger, BED-type containing 9
Cat # 16193450
100 uL
Cat # 15730361
100 µL
Cat # 15877903
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.