Sequence: MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK
Diamine acetyltransferase 2; diamine N-acetyltransferase 2; polyamine N-acetyltransferase 2; Spermidine/spermine N(1)-acetyltransferase 2; SSAT-2; SSAT2; Thialysine N-epsilon-acetyltransferase
Cat # 16125509
50 µg
Cat # 16805824
150 µL
Cat # 15985534
100 µL
Cat # 15781172
100 µL
Cat # 15965534
100 µL
Cat # 15577262
100 µL
Cat # 16815824
20 µL
Cat # 15712501
100 µL
Cat # 15903685
100 µL
Cat # 15975534
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.