Sequence: MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE
DKFZp667L2214/FLJ11526/FLJ23595/FLJ36497/NS4ATP2; HCV non-structural protein 4A-transactivated protein 2; Histone deacetylase complex subunit SAP30L; SAP30-like; Sin3 corepressor complex subunit SAP30L; Sin3-associated protein p30-like; Sin3A associated protein p30-like
Cat # 16153719
50 µg
Cat # 11528960
100 µL
Cat # 16047577
100 ug
Cat # 15998264
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.