Sequence: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Protein S-100E; Protein S100-A3; S100 calcium-binding protein A3; S100E
Cat # 16134845
50 uL
Cat # 16810014
20 µL
Cat # 17188263
100 µL
Cat # 16144845
100 µg
Cat # 15988724
100 µL
Cat # 16092587
50 ug
Cat # 16314684
100 µL
Cat # 15546281
100 µg
Cat # 16800014
150 µL
Cat # 15525242
100 µL
Cat # 17208643
100 µL
Cat # 16380575
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.