Sequence: MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Protein S100-A13; S100 calcium-binding protein A13
Cat # 16184865
50 uL
Cat # 15711971
100 µL
Cat # 16669464
100 µL
Cat # 13448674
100 ug
Cat # 15598102
100 µg
Cat # 15782504
25 ug
Cat # 16114875
100 µg
Cat # 16813944
150 µL
Cat # 16394314
100 µL
Cat # 16304684
100 µL
Cat # 15241887
100 ug
Cat # 13491735
50 ug
Cat # 15736854
25 ug
Cat # 16823944
20 µL
Cat # 13438674
100 ug
Cat # 15772504
25 ug
Cat # 16373574
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.