Sequence: TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGL
Calgizzarin; epididymis secretory protein Li 43; Metastatic lymph node gene 70 protein; MLN 70; MLN70/S100C; Protein S100-A11; Protein S100-A11, N-terminally processed; Protein S100-C; S100 calcium-binding protein A11; S100 calcium-binding protein A11 (calgizzarin)
Cat # 16094705
100 µg
Cat # 15777334
25 ug
Cat # 15737194
25 ug
Cat # 13410846
100 ug
Cat # 15905515
100 µg
Cat # 13267658
100 µL
Cat # 16130482
100 µg
Cat # 16856493
20 µL
Cat # 13438954
100 ug
Cat # 16330585
100 µL
Cat # 16374314
100 µL
Cat # 13420756
100 ug
Cat # 16629244
100 µL
Cat # 11529030
500 µg
Cat # 16846975
150 µL
Cat # 15722774
25 ug
Cat # 16846493
150 µL
Cat # 16099995
100 ug
Cat # 17178263
100 µL
Cat # 16328054
100 µL
Cat # 16856975
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.