Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY
Protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha; S100 alpha; S100 calcium-binding protein A1; S100 protein, alpha polypeptide; S100/S100-alpha/S100A
Cat # 16154835
50 uL
Cat # 17169045
100 µL
Cat # 11576413
1 mL
Cat # 16074366
100 uL
Cat # 16815484
20 µL
Cat # 17296733
100 µL
Cat # 17169035
100 µL
Cat # 11584313
100 µg
Cat # 16338484
100 µL
Cat # 11335303
100 µL
Cat # 16033226
100 ug
Cat # 16168630
100 µL
Cat # 16085736
100 ug
Cat # 16023856
200 µL
Cat # 16023226
100 ug
Cat # 16505710
100 µL
Cat # 16030146
100 uL
Cat # 16042617
200 uL
Cat # 15792574
25 ug
Cat # 11568611
100 µg
Cat # 15745736
0.1 mg
Cat # 11525922
200 µL
Cat # 13491765
50 ug
Cat # 16805484
150 µL
Cat # 13468744
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.