Sequence: QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRAC
CAAX prenyl protease 2; FACE-2; FACE2/RCE1A/RCE1B; farnesylated protein-converting enzyme 2; Farnesylated proteins-converting enzyme 2; hRCE1; Prenyl protein-specific endoprotease 2; RCE1 homolog; RCE1 homolog, prenyl protein peptidase
Cat # 16171566
50 uL
Cat # 16093927
400 uL
Cat # 15545592
100 µL
Cat # 16501902
100 µg
Cat # 16181566
100 µg
Cat # 17219333
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.