Sequence: TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPI
CHC1-L; CHC1L; Chromosome condensation 1-like; RCC1 and BTB domain-containing protein 2; RCC1-like G exchanging factor; RCC1-like G exchanging factor RLG; regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2; Regulator of chromosome condensation and BTB domain-containing protein 2
Cat # 16186244
200 uL
Cat # 16176244
50 ug
Cat # 16156244
50 µg
Cat # 16841344
20 µL
Cat # 16081657
100 ug
Cat # 15746981
100 µL
Cat # 13259518
100 µL
Cat # 16166244
100 ug
Cat # 16831344
150 µL
Cat # 17150544
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.