Sequence: MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAACSFSIIAVSSLSCFFPLLFVKKNCL
Calcipressin-2; CSP2/DSCR1L1/MCIP2/RCN2/ZAKI-4/ZAKI4/hRCN2; Down syndrome candidate region 1-like 1; Down syndrome critical region gene 1-like 1; MCIP2; Myocyte-enriched calcineurin-interacting protein 2; Regulator of calcineurin 2; thyroid hormone-responsive (skin fibroblasts); Thyroid hormone-responsive protein ZAKI-4
Cat # 16156758
50 µg
Cat # 12808842
100 µg
Cat # 15780642
100 µL
Cat # 15566222
100 µL
Cat # 16840854
150 µL
Cat # 16850854
20 µL
Cat # 16069047
400 uL
Cat # 15672375
100 µg
Cat # 16042307
100 ug
Cat # 17150774
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.