Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILSVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
Binder of OVCA1-1; BOV-1; BOV-1A/BOV-1B/BOV-1C/MDS014/RBM8/RBM8B/Y14/ZNRP/ZRNP1; ribonucleoprotein RBM8; Ribonucleoprotein RBM8A; RNA binding motif protein 8B; RNA-binding motif protein 8A; RNA-binding protein 8A; RNA-binding protein Y14
Cat # 16174242
100 µg
Cat # 16392895
100 µL
Cat # 17236803
100 µL
Cat # 16189190
100 ug
Cat # 15545042
100 µL
Cat # 16377004
100 µl
Cat # 16005706
100 uL
Cat # 15708925
0.1 ml
Cat # 16151476
50 µL
Cat # 15791721
100 µL
Cat # 17116468
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.