Sequence: SSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEESSGNISKDLKDKIVEKAKESLDTAAVVQVGISRNQ
DKFZp686P0638/DKFZp761B2423/MY038/P2P-R/PACT/RBQ-1/SNAMA; E3 ubiquitin-protein ligase RBBP6; p53-associated cellular protein of testis; Proliferation potential-related protein; Protein P2P-R; RB-binding Q-protein 1; RBQ-1; retinoblastoma binding protein 6; Retinoblastoma-binding protein 6; retinoblastoma-binding protein 6, isoform 3; Retinoblastoma-binding Q protein 1; RING-type E3 ubiquitin transferase RBBP6
Cat # 16144165
50 uL
Cat # 15705977
0.1 ml
Cat # 13288208
100 µL
Cat # 16899243
20 µL
Cat # 16610555
100 µL
Cat # 15565372
100 µL
Cat # 16083507
100 ug
Cat # 17199093
100 µL
Cat # 16093507
100 ug
Cat # 15737551
100 µL
Cat # 15933595
100 µL
Cat # 16889243
150 µL
Cat # 16164165
100 µg
Cat # 16154165
50 µg
Cat # 16073507
100 ug
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.