Sequence: MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
GTP-binding protein Rhes; MGC:4834/Rhes/TEM2; Ras homolog enriched in striatum; RASD family, member 2; Tumor endothelial marker 2
Cat # 16104816
50 µg
Cat # 15974934
100 µL
Cat # 15904914
100 µL
Cat # 16070637
100 ug
Cat # 16118630
100 µL
Cat # 16187442
100 µg
Cat # 15720171
100 µL
Cat # 15984934
100 µL
Cat # 16637714
100 µL
Cat # 12898612
100 µg
Cat # 16060637
100 ug
Cat # 12888612
100 µg
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.