Sequence: PRQNSTGQAQIRKVDQGGLGARAKAPPSLPHSASLRSTGSMSVVSAALVAEPVQNGSRSRQQSSSSRESPVPKVRAIQRQQTQQVQSPVDSATMSPVERTAAWVLNNGQY
MGC129919/nGAP; Ras GTPase-activating protein nGAP; Ras protein activator like 1; RAS protein activator-like 2
Cat # 16154110
100 uL
Cat # 13496307
100 µL
Cat # 15664795
100 µL
Cat # 16577731
100 µL
Cat # 15795516
0.1 ml
Cat # 15782141
100 µL
Cat # 16831675
150 µL
Cat # 16841675
20 µL
Cat # 16667384
100 µL
Cat # 16174210
100 uL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.