Sequence: DGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI
GAP1(IP4BP); GAP1IP4BP/GAPIII/MGC46517/MGC47588; GTPase activating protein III; GTPase-activating protein 1 family, inositol 1,3,4,5-tetrakisphosphate-binding protein; Ins P4-binding protein; Ins(1,3,4,5)P4-binding protein; Ras GTPase-activating protein 3
Cat # 16144156
200 uL
Cat # 16134156
200 uL
Cat # 16039877
100 ug
Cat # 16194146
50 uL
Cat # 13209998
100 µL
Cat # 17139163
100 µL
Cat # 15922045
100 µL
Cat # 13484937
100 µL
Cat # 16842664
150 µL
Cat # 15598982
100 µg
Cat # 16124156
100 µg
Cat # 16698284
100 µL
Cat # 16852664
20 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.