Sequence: AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR
CM-AVM/CMAVM/DKFZp434N071/GAP/PKWS/RASA/RASGAP/p120GAP/p120RASGAP; GAP; p120 RAS GTPase activating protein; p120GAP; Ras GTPase-activating protein 1; Ras p21 protein activator; RAS p21 protein activator (GTPase activating protein) 1; triphosphatase-activating protein
Cat # 16124145
100 ug
Cat # 16134145
100 ug
Cat # 11585822
100 µg
Cat # 16184135
50 µg
Cat # 16194135
100 uL
Cat # 16658924
100 µL
Cat # 16114145
200 uL
Cat # 15807573
100 µL
Cat # 16031408
100 ug
Cat # 16300295
100 µL
Cat # 17299983
100 µg
Cat # 15995475
100 µg
Cat # 17138203
100 µL
Cat # 16104145
100 µg
Cat # 16164135
50 uL
Cat # 16321605
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.