Sequence: IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
-; brain antigen RAB3B; Ras-related protein Rab-3B
Cat # 16193995
100 µg
Cat # 15934384
200 µL
Cat # 16550932
100 µg
Cat # 16173995
100 µg
Cat # 16835104
20 µL
Cat # 16119971
50 µg
Cat # 16825104
150 µL
Cat # 16183995
200 uL
Cat # 13482137
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.