Sequence: LSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
Nine amino-acid residue-repeats; RAB39/RAH; Ras-related protein Rab-34; Ras-related protein Rab-34, isoform NARR; Ras-related protein Rab-39; Ras-related protein Rah
Cat # 16175513
100 µg
Cat # 16633945
100 µL
Cat # 16825625
20 µL
Cat # 15752321
100 µL
Cat # 16536201
100 µL
Cat # 15546311
100 µg
Cat # 16815625
150 µL
Cat # 15546812
100 µL
Searching for an antibody we don't offer? We make custom antibodies for specific targets, species and applications.
More than 18,000 custom antibodies created so far.
Talk To A Specialist NowIf an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.